PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004487221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 187aa    MW: 21739.2 Da    PI: 9.8126
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004487221.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.27.8e-221659245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +i+ ks  qvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k
  XP_004487221.1 16 KIQKKSHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPANK 59
                    79999************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.736767IPR002100Transcription factor, MADS-box
SMARTSM004326.7E-30766IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-27886IPR002100Transcription factor, MADS-box
CDDcd002651.71E-32877No hitNo description
PRINTSPR004042.5E-17929IPR002100Transcription factor, MADS-box
PfamPF003195.7E-251663IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-172944IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-174465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSKKTSLGRQ KILIEKIQKK SHLQVTFSKR RSGLFKKASE LCTLCGVEIA IIVFSPANKP  60
FSFGHSEIES IIDRYLTRNP PQESNTHQIV EAHRNANVHD LNMQLTQLLN HLEIEKKKGE  120
EIDHMRKARQ RKFWWECPID ELGFYELLQL KVSIEELKKN LGKFASKCIM ELSNMSSPNI  180
GFQYGYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-19892186Myocyte-specific enhancer factor 2A
3kov_B4e-19892186Myocyte-specific enhancer factor 2A
3kov_I4e-19892186Myocyte-specific enhancer factor 2A
3kov_J4e-19892186Myocyte-specific enhancer factor 2A
3p57_A4e-19892186Myocyte-specific enhancer factor 2A
3p57_B4e-19892186Myocyte-specific enhancer factor 2A
3p57_C4e-19892186Myocyte-specific enhancer factor 2A
3p57_D4e-19892186Myocyte-specific enhancer factor 2A
3p57_I4e-19892186Myocyte-specific enhancer factor 2A
3p57_J4e-19892186Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004487221.11e-138PREDICTED: agamous-like MADS-box protein AGL61
SwissprotQ4PSU42e-54AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLG7J8131e-108G7J813_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27350.22e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-55AGAMOUS-like 61